DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl4

DIOPT Version :10

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_683743.2 Gene:Elovl4 / 83603 MGIID:1933331 Length:312 Species:Mus musculus


Alignment Length:259 Identity:88/259 - (33%)
Similarity:143/259 - (55%) Gaps:31/259 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVL 83
            ||:.||||:::|.:||||||. ||.|:|::|:|:.:|.|:..||...::.|          ||:.
Mouse    41 PLMQSPWPTISISTLYLLFVW-LGPKWMKDREPFQMRLVLIIYNFGMVLLN----------LFIF 94

  Fly    84 K---------AYDLRCITKLPLDHELKSRERWLT---YSYFFNKFMDLLETVFFVLRKKDRQISF 136
            :         .|...|.:   :|:.....|..:.   :.||.:|.::.|:||||:||||:.|:||
Mouse    95 RELFMGSYNAGYSYICQS---VDYSNDVNEVRIAGALWWYFVSKGVEYLDTVFFILRKKNNQVSF 156

  Fly   137 LHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITI 200
            |||:||..|....::.|.:.. ||..|....:|..:|||||:||.|::....:|... ||:|:|:
Mouse   157 LHVYHHCTMFTLWWIGIKWVA-GGQAFFGAQMNSFIHVIMYSYYGLTAFGPWIQKYLWWKRYLTM 220

  Fly   201 VQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKS 264
            :|||||.:.:.:.:.:| ..||...:.:.:..:..:.:||.:|.|||...|  |..||....|:
Mouse   221 LQLVQFHVTIGHTALSL-YTDCPFPKWMHWALIAYAISFIFLFLNFYTRTY--NEPKQSKTGKT 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:460083 86/252 (34%)
Elovl4NP_683743.2 ELO 41..278 CDD:460083 87/254 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 273..312 3/9 (33%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03204, ECO:0000269|PubMed:24569140 308..312
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.