DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and ELOVL3

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_689523.1 Gene:ELOVL3 / 83401 HGNCID:18047 Length:270 Species:Homo sapiens


Alignment Length:278 Identity:62/278 - (22%)
Similarity:122/278 - (43%) Gaps:68/278 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLR----------------RVIRAYNIMQIV 67
            |.....|.:...::|..|.::.:|:.:|:.||.::|:                ..:|.:.||   
Human    28 PFFEEYWATSFPIALIYLVLIAVGQNYMKERKGFNLQGPLILWSFCLAIFSILGAVRMWGIM--- 89

  Fly    68 YNGVILIAG--------LHFLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVF 124
              |.:|:.|        ::|                :|:   |..::.::.:..:|.::|.:|.|
Human    90 --GTVLLTGGLKQTVCFINF----------------IDN---STVKFWSWVFLLSKVIELGDTAF 133

  Fly   125 FVLRKKDRQISFLHVFHH----LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSV 185
            .:|||  |.:.|:|.:||    :..|||....:...|:..|      :|..||.|||.||.|.:.
Human   134 IILRK--RPLIFIHWYHHSTVLVYTSFGYKNKVPAGGWFVT------MNFGVHAIMYTYYTLKAA 190

  Fly   186 SKDVQTSRW-KKYITIVQLVQFIL--VLANFSYTLMQPD-CNASRTVIYTGMFISTTFILMFANF 246
              :|:..:. ...||.:|::|..:  :::..:|...|.. |:.:...::....:..|:.::||:|
Human   191 --NVKPPKMLPMLITSLQILQMFVGAIVSILTYIWRQDQGCHTTMEHLFWSFILYMTYFILFAHF 253

  Fly   247 YIHNYILNGSKQKSALKS 264
            :...||  ..|.|:..||
Human   254 FCQTYI--RPKVKAKTKS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 59/271 (22%)
ELOVL3NP_689523.1 ELO 29..266 CDD:307345 59/272 (22%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03203 266..270 2/4 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.