DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and HOS3-1

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001329164.1 Gene:HOS3-1 / 829836 AraportID:AT4G36830 Length:308 Species:Arabidopsis thaliana


Alignment Length:257 Identity:55/257 - (21%)
Similarity:102/257 - (39%) Gaps:52/257 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLNG-TLIISEDPVRLPLIGSPWPS-----------LTIVSLYL-----LFVLKLGRKFMENRKP 51
            |:|. |..:||.|.   ::|..|.:           .|.:|||:     |.:| |......||. 
plant     5 LINSITYFLSEHPY---IVGFRWSNSQSWGSTWSFLFTSISLYIAVSSSLHIL-LSAVRRSNRS- 64

  Fly    52 YDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLKAYDLRCITK-------------LPLDHELKSR 103
            ..|..:...::::..:.:..| .||:......:..|.|.:.:             .||......|
plant    65 VPLGHIPEIHSLLMSILSATI-FAGILLSAAAEIRDTRWLWRRSKTATPLQWLLCFPLGTRPSGR 128

  Fly   104 ERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLL 168
            ..:.:|.::..:|:.:..|:|.|||  .|:::...:|.:.||:|..:|.:.|:.....|  ..|.
plant   129 VFFWSYVFYLTRFLHMFRTIFAVLR--SRRLAVSQLFCNSVMAFTSFLWLEFSQSYQIL--AILS 189

  Fly   169 NVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFILVLAN-------FSYTLMQPDCN 223
            ...|:.::|.|.:.:...  :..|.:..::...|||   ||..|       .:..|.:..||
plant   190 TTLVYSVVYGYRFWTGFG--LPGSAFPSFVVNCQLV---LVGCNLVSHAGVLTMHLFKGGCN 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 49/241 (20%)
HOS3-1NP_001329164.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.