DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and AT3G06460

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_187297.1 Gene:AT3G06460 / 819823 AraportID:AT3G06460 Length:298 Species:Arabidopsis thaliana


Alignment Length:237 Identity:63/237 - (26%)
Similarity:115/237 - (48%) Gaps:27/237 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVSLYL--LFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFV------LKAY 86
            :|||||  .|:|:.....:....|..|:.:...::::..:.: :.:..|.....:      .:.:
plant    39 VVSLYLSATFLLRYTVDSLPTLGPRILKPITAVHSLILFLLS-LTMAVGCTLSLISSSDPKARLF 102

  Fly    87 DLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLVMSFGGYL 151
            |..|   .|||.:.|....:....::.:|.::.::|:..:|.|..:::|||||:||..:....||
plant   103 DAVC---FPLDVKPKGPLFFWAQVFYLSKILEFVDTLLIILNKSIQRLSFLHVYHHATVVILCYL 164

  Fly   152 HITFNGYGGTLFPLCL-LNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFILVLANFSY 215
            .:...   .::||:.| ||..||||||.||:|.::.   ...:|||.:|..|:|||...: ....
plant   165 WLRTR---QSMFPVGLVLNSTVHVIMYGYYFLCAIG---SRPKWKKLVTNFQMVQFAFGM-GLGA 222

  Fly   216 TLMQPD------CNASRTVIYTGMFISTTFILMFANFYIHNY 251
            ..|.|:      |....||.:.|:| :.:.:.:|.||:..||
plant   223 AWMLPEHYFGSGCAGIWTVYFNGVF-TASLLALFYNFHSKNY 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 63/237 (27%)
AT3G06460NP_187297.1 ELO 28..270 CDD:395916 63/237 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.780

Return to query results.
Submit another query.