DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elovl8a

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001070061.1 Gene:elovl8a / 767653 ZFINID:ZDB-GENE-060929-240 Length:268 Species:Danio rerio


Alignment Length:248 Identity:82/248 - (33%)
Similarity:139/248 - (56%) Gaps:23/248 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFV-- 82
            |:.||.|...|...||:.|. .|.|.|.:|:|.:::.::..||     ::.|.|.|.:.:.|.  
Zfish    32 LVYSPLPVGGIFLCYLVMVW-FGPKLMVHREPVNIQALLIIYN-----FSMVCLSAYMFYEFTVS 90

  Fly    83 --LKAYDLRCITKLPLDH---ELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHH 142
              |.:|.|.|   .|:|:   .|..|...:.:.::|:|.::|.:|:||:||||:.|::||||:||
Zfish    91 SWLASYSLLC---QPVDYTENPLPMRMARVCWWFYFSKVIELADTMFFILRKKNNQLTFLHVYHH 152

  Fly   143 LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQF 206
            ..|.|..:..:.:.. ||..|.:.|:|..|||:||.||.|:::...:|... ||:|:|.:||:||
Zfish   153 GTMIFNWWAGVKYVA-GGQSFLIGLINSFVHVVMYMYYGLAALGPQMQKYLWWKRYLTSLQLLQF 216

  Fly   207 ILVLANFSYTLMQPDCN--ASRTVIYTGMFISTTFILMFANFYIHNYILNGSK 257
            .:|..:.::.| ..||:  .|..::..|..:|  .|.:|:|||..:|:...:|
Zfish   217 FIVTIHTAFNL-YADCDFPDSMNMVVLGYALS--LIALFSNFYYQSYLSKKTK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 82/248 (33%)
elovl8aNP_001070061.1 ELO 35..266 CDD:279492 80/243 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581327
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.750

Return to query results.
Submit another query.