DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl7

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_083277.3 Gene:Elovl7 / 74559 MGIID:1921809 Length:281 Species:Mus musculus


Alignment Length:245 Identity:91/245 - (37%)
Similarity:135/245 - (55%) Gaps:26/245 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLK 84
            |:.||.|...|:.||:.||..||.|.||||||::|::.:..||...::::     ..:.:.||:.
Mouse    30 LMSSPLPQTIILGLYVYFVTSLGPKLMENRKPFELKKAMITYNFFIVLFS-----VYMCYEFVMS 89

  Fly    85 ----AYDLRCITKLPLDHELKSRER------WLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHV 139
                .|..||..   :|:....|..      ||   |:|:||::||:|:|||||||:.|::||||
Mouse    90 GWGTGYSFRCDI---VDYSQSPRAMRMVHTCWL---YYFSKFIELLDTIFFVLRKKNSQVTFLHV 148

  Fly   140 FHHLVMSFGGYLHITFNGYG-GTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQ 202
            |||.:|.:..:..:.|...| ||..  ..||.||||:||:||.|.::....|... |||::|.:|
Mouse   149 FHHTIMPWTWWFGVKFAAGGLGTFH--AFLNTAVHVVMYSYYGLCAMGPAYQKYLWWKKHLTSLQ 211

  Fly   203 LVQFILVLANFSYTLMQPDCNASRTV-IYTGMFISTTFILMFANFYIHNY 251
            ||||:||..:........|||....| :|..|.....|:|:|.:|:...|
Mouse   212 LVQFVLVTIHIGQIFFMEDCNYQYPVFLYIIMSYGCIFLLLFLHFWYRAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 91/245 (37%)
Elovl7NP_083277.3 ELO 30..269 CDD:279492 91/245 (37%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03207 277..281
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.