DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl1

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001037740.1 Gene:Elovl1 / 679532 RGDID:1587151 Length:279 Species:Rattus norvegicus


Alignment Length:249 Identity:90/249 - (36%)
Similarity:135/249 - (54%) Gaps:32/249 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNI------MQIVYNGVILIAGL 77
            ||:|||....:|:..|:.|||.||.:.|.||||:.||..:..||.      :.|||.  .|::|.
  Rat    23 PLMGSPLLITSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLVTLSLYIVYE--FLMSGW 85

  Fly    78 HFLFVLKAYDLRCITKLPLDHELKS------RERWLTYSYFFNKFMDLLETVFFVLRKKDRQISF 136
                 |..|..||.   |:|.....      |..||   :..:|.::|::||.|:|||||.|::|
  Rat    86 -----LSTYTWRCD---PVDFSNNPEALRMVRVAWL---FMLSKVIELMDTVIFILRKKDGQVTF 139

  Fly   137 LHVFHHLVMSFGGY--LHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYI 198
            ||||||.|:.:..:  :.|...|.|..   ..::|.:|||:||.||.||::....|... |||::
  Rat   140 LHVFHHSVLPWSWWWGIKIAPGGMGSF---HAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHM 201

  Fly   199 TIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFI-STTFILMFANFYIHNY 251
            |.:||:||:||..:.|.....|.||....:|...::: .|.|.::|:||:.|:|
  Rat   202 TAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSY 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 90/249 (36%)
Elovl1NP_001037740.1 ELO 23..260 CDD:395916 90/249 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
76.920

Return to query results.
Submit another query.