DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and ELOVL5

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001229757.1 Gene:ELOVL5 / 60481 HGNCID:21308 Length:326 Species:Homo sapiens


Alignment Length:275 Identity:82/275 - (29%)
Similarity:127/275 - (46%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 IVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLKAYDLR---CI 91
            |.|:..|.::.||.|:|.|::|:..|.::..||:      |:.|:: |:.....|....|   |.
Human    37 ICSVIYLLIVWLGPKYMRNKQPFSCRGILVVYNL------GLTLLS-LYMFCESKREQPRRSACA 94

  Fly    92 TKL-PLDHELKSRERWLT----------------------------YSYFFNKFMDLLETVFFVL 127
            ::. |...:.....|.:|                            :.|:|:|.::.::|.||:|
Human    95 SRTDPSTQQQLPENRLVTGVWEGKYNFFCQGTRTAGESDMKIIRVLWWYYFSKLIEFMDTFFFIL 159

  Fly   128 RKKDRQISFLHVFHH--------LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSS 184
            ||.:.||:.|||:||        .||::....|..|   |.|      ||..:||:||:||.|||
Human   160 RKNNHQITVLHVYHHASMLNIWWFVMNWVPCGHSYF---GAT------LNSFIHVLMYSYYGLSS 215

  Fly   185 VSKDVQTSRWKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIH 249
            |........||||||..||:||:|.:...|..::.| |......:|..:....:.|.:|.||||.
Human   216 VPSMRPYLWWKKYITQGQLLQFVLTIIQTSCGVIWP-CTFPLGWLYFQIGYMISLIALFTNFYIQ 279

  Fly   250 NYILNG-SKQKSALK 263
            .|...| |::|..||
Human   280 TYNKKGASRRKDHLK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 79/269 (29%)
ELOVL5NP_001229757.1 ELO 27..288 CDD:366492 78/267 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.