DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elovl6

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001017257.2 Gene:elovl6 / 550011 XenbaseID:XB-GENE-942876 Length:265 Species:Xenopus tropicalis


Alignment Length:258 Identity:65/258 - (25%)
Similarity:127/258 - (49%) Gaps:44/258 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYN--GVILIAGLHFLFVLKAYDLR 89
            |....:||..|:.. ||..|:.|:.::||:.:..:::...|::  |.:. .|.:.|::|....|:
 Frog    33 SFLFSALYAAFIFG-GRHLMKQREKFELRKPLILWSLSLAVFSIFGAVR-TGAYMLYILMTKGLK 95

  Fly    90 ---C--------ITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143
               |        ::|.           | .|::..:|..:|.:|:|.:|||  :::.|||.:||:
 Frog    96 QSVCDQSFYYGPVSKF-----------W-AYAFVLSKAPELGDTIFIILRK--QKLIFLHWYHHI 146

  Fly   144 -VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFI 207
             |:.:..|.:......||...   .:|..||.:||:||.|.:....| :.::...||:.|:.|.|
 Frog   147 TVLLYSWYSYKDMVAGGGWFM---TMNYGVHAVMYSYYALRAAGFRV-SRKFAMLITLSQITQMI 207

  Fly   208 L-VLAN---FSYTLMQPDCNAS-RTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            : .:.|   ||: :.|..|.:. :.::::.:...:.|:| |.:|:...||   :|.:.|.|:|
 Frog   208 IGCVVNYLVFSW-MQQGQCPSHVQNIVWSSIMYLSYFVL-FCHFFFEAYI---TKTRKASKAD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 62/250 (25%)
elovl6NP_001017257.2 ELO 25..262 CDD:366492 62/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.