DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and ELOVL2

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_011513018.1 Gene:ELOVL2 / 54898 HGNCID:14416 Length:326 Species:Homo sapiens


Alignment Length:252 Identity:78/252 - (30%)
Similarity:133/252 - (52%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLK 84
            ::.|..|:..:..:|||.:. ||.|:|:||....||.::..||:      |:.|::......::.
Human    61 MLDSYLPTFFLTVMYLLSIW-LGNKYMKNRPALSLRGILTLYNL------GITLLSAYMLAELIL 118

  Fly    85 A-----YDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLV 144
            :     |:|:| ..|....|...|...:.:.|:|:|.::.|:|:|||||||..||:||||:||..
Human   119 STWEGGYNLQC-QDLTSAGEADIRVAKVLWWYYFSKSVEFLDTIFFVLRKKTSQITFLHVYHHAS 182

  Fly   145 MSFGGYLHITFNGYGGTLF-PLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFIL 208
            |....:..:.:...|.:.| |  .||..:|::||:||.||......:...||||:|..|||||:|
Human   183 MFNIWWCVLNWIPCGQSFFGP--TLNSFIHILMYSYYGLSVFPSMHKYLWWKKYLTQAQLVQFVL 245

  Fly   209 VLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            .:.:....:::|.......:|:...:: .|.:::|.|||:..|      :|..:|.|
Human   246 TITHTMSAVVKPCGFPFGCLIFQSSYM-LTLVILFLNFYVQTY------RKKPMKKD 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 75/244 (31%)
ELOVL2XP_011513018.1 ELO 60..294 CDD:279492 76/249 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.