DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elovl2

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001016159.1 Gene:elovl2 / 548913 XenbaseID:XB-GENE-489753 Length:296 Species:Xenopus tropicalis


Alignment Length:259 Identity:84/259 - (32%)
Similarity:136/259 - (52%) Gaps:37/259 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVL- 83
            ::.|..|:|.:..||.|.:. ||.|:|:||..:.||..:       ||||.|:.:..|:.|..| 
 Frog    31 MLDSYLPTLFLTLLYFLSIW-LGTKYMQNRPAFSLRGHL-------IVYNLVVTLLSLYMLIELI 87

  Fly    84 -----KAYDLRCITKLPLDHELKSRER------WLTYSYFFNKFMDLLETVFFVLRKKDRQISFL 137
                 ..|:|:|..   ||...|:..|      |    |:|:|.::.::|:|||||||:.||:||
 Frog    88 LSTWEGGYNLQCQN---LDSAGKADVRVAKVLWW----YYFSKAIEFMDTIFFVLRKKNSQITFL 145

  Fly   138 HVFHHLVMSFGGYLHITFNGYGGTLF-PLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIV 201
            ||:||..|....:..:.:...|.:.| |  .||..:||:||:||.||.:....:...||:|:|..
 Frog   146 HVYHHASMFNIWWCVLNWIPCGQSFFGP--TLNSFIHVLMYSYYGLSVIPSMHKYLWWKRYLTQA 208

  Fly   202 QLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            |||||:|.:.:.....::|.......:::...::: |.:::|.|||:..|      :|...|||
 Frog   209 QLVQFLLTITHTLSAAVKPCGFPFGCLMFQASYMA-TLVILFVNFYLKTY------KKRPSKSD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 80/251 (32%)
elovl2NP_001016159.1 ELO 49..263 CDD:366492 75/237 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.