DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl1

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001034265.1 Gene:Elovl1 / 54325 MGIID:1858959 Length:279 Species:Mus musculus


Alignment Length:273 Identity:91/273 - (33%)
Similarity:143/273 - (52%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFV- 82
            ||:|||....:|:..|:.|:|.||.:.|.||||:.||.       ..||||..::|..|:.::. 
Mouse    23 PLMGSPLLITSILLTYVYFILSLGPRIMANRKPFQLRG-------FMIVYNFSLVILSLYIVYEF 80

  Fly    83 -----LKAYDLRCITKLPLDHELKS------RERWLTYSYFFNKFMDLLETVFFVLRKKDRQISF 136
                 |..|..||.   |:|.....      |..||   :..:|.::|::||.|:|||||.|::|
Mouse    81 LMSGWLSTYTWRCD---PIDFSNSPEALRMVRVAWL---FMLSKVIELMDTVIFILRKKDGQVTF 139

  Fly   137 LHVFHHLVMSFGGY--LHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYI 198
            ||||||.|:.:..:  :.|...|.|..   ..::|.:|||:||.||.||::....|... |||::
Mouse   140 LHVFHHSVLPWSWWWGIKIAPGGMGSF---HAMINSSVHVVMYLYYGLSALGPVAQPYLWWKKHM 201

  Fly   199 TIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFI-STTFILMFANFYIHNYI---------- 252
            |.:||:||:||..:.|.....|.||....:|...::: .|.|.::|:||:.|:|.          
Mouse   202 TAIQLIQFVLVSLHISQYYFMPSCNYQYPIIIHLIWMYGTIFFILFSNFWYHSYTKGKRLPRAVQ 266

  Fly   253 LNGSKQKSALKSD 265
            .||:...:.:|::
Mouse   267 QNGAPATTKVKAN 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 90/265 (34%)
Elovl1NP_001034265.1 ELO 23..260 CDD:366492 88/252 (35%)
Di-lysine motif. /evidence=ECO:0000255|HAMAP-Rule:MF_03201 275..279 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.