DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl2

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:XP_038951934.1 Gene:Elovl2 / 498728 RGDID:1308605 Length:296 Species:Rattus norvegicus


Alignment Length:252 Identity:82/252 - (32%)
Similarity:135/252 - (53%) Gaps:23/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFL-FVL 83
            |:.|..|:.|:..:|||.:. ||.|:|:||....||.::..||:      |:.|::....: .||
  Rat    31 LLDSYLPTFTLTIVYLLSIW-LGNKYMKNRPALSLRGILTLYNL------GITLLSAYMLVELVL 88

  Fly    84 KA----YDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLV 144
            .:    |:|:| ..|....|...|...:.:.|:|:|.::.|:|:|||||||..||:||||:||..
  Rat    89 SSWEGGYNLQC-QNLDSAGEGDIRVAKVLWWYYFSKLVEFLDTIFFVLRKKTSQITFLHVYHHAS 152

  Fly   145 MSFGGYLHITFNGYGGTLF-PLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFIL 208
            |....:..:.:...|.:.| |  .||..:|::||:||.||......:...||||:|..|||||:|
  Rat   153 MFNIWWCVLNWIPCGQSFFGP--TLNSFIHILMYSYYGLSVFPSMHRYLWWKKYLTQAQLVQFVL 215

  Fly   209 VLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            .:.:....:::|.......:|:...:: .|.:::|.||||..|      :|..:|.:
  Rat   216 TITHTLSAVVKPCGFPFGCLIFQSSYM-MTLVILFLNFYIQTY------RKKPMKKE 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 80/244 (33%)
Elovl2XP_038951934.1 ELO 30..264 CDD:395916 81/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.