DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and zgc:92749

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001002570.1 Gene:zgc:92749 / 436843 ZFINID:ZDB-GENE-040718-309 Length:266 Species:Danio rerio


Alignment Length:252 Identity:65/252 - (25%)
Similarity:119/252 - (47%) Gaps:28/252 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGV-ILIAGLHFLFVLKAYDLR- 89
            |..:...|.:.:. ||..||::|:..|||..:..:::...|::.| .|..|.:...|:.:...| 
Zfish    30 SFVLSGTYAVLIF-LGHMFMKDRQKLDLRAPLVLWSMSLAVFSIVGTLRTGWYMFNVVCSEGFRQ 93

  Fly    90 --CITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHH---LVMSFGG 149
              |.|    |.......::..:::..:|..:|.:|||.||||  :::.|||.:||   |:.|:..
Zfish    94 SVCDT----DFYSAPVSKFWAFAFAISKAPELGDTVFVVLRK--QRLIFLHWYHHITVLLYSWFS 152

  Fly   150 YL-HITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQFI--LVL 210
            |. |:...|:      ...:|..||..||:||  ::.:..|:..| :...||::|:.|..  |.:
Zfish   153 YKDHVAGGGW------FMSMNFTVHAFMYSYY--TAKAAGVRVPRAFAMLITVLQISQMAAGLTV 209

  Fly   211 ANFSYTLM-QPDCNASRTVIYTGMFISTTFILMFANFYIHNYI-LNGSKQKSALKSD 265
            ....|:.. :..|.::...|..|..:..:::.:|..|:..:|| .:...||..||.|
Zfish   210 LGLVYSWKHEQHCKSTDNNIIFGSAMYFSYLPLFCAFFYQSYIRRSDGGQKRRLKRD 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 60/244 (25%)
zgc:92749NP_001002570.1 ELO 22..255 CDD:279492 60/239 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.