DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and bond

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651062.3 Gene:bond / 42657 FlyBaseID:FBgn0260942 Length:322 Species:Drosophila melanogaster


Alignment Length:253 Identity:100/253 - (39%)
Similarity:150/253 - (59%) Gaps:30/253 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLK 84
            |:.||.|.:.:|.:||.||||:|.::|:||||.||:|::..||..|::|:..:....:....|:.
  Fly    28 LMSSPMPVVAVVLVYLAFVLKIGPEYMKNRKPMDLKRIMVFYNAFQVLYSIWMCRTSIQESNVMA 92

  Fly    85 A-YDLRCITKLPLDHEL-KSRERWLT-YS----YFFNKFMDLLETVFFVLRKKDRQISFLHVFHH 142
            : :..:|        |: ::||:.|| ||    |||:|.:|||:|.||||||||.|:|||||:||
  Fly    93 SIFSKKC--------EINRTREQNLTLYSGAWFYFFSKIIDLLDTTFFVLRKKDNQVSFLHVYHH 149

  Fly   143 --LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLV 204
              .|:...|||... .|..|.:  :.:||..||:|||.||.::::....|... ||||:|.:||:
  Fly   150 TITVLFSWGYLKYA-PGEQGVI--IGILNSGVHIIMYFYYMVAAMGPQYQKYLWWKKYMTSIQLI 211

  Fly   205 QFILVLANFSYTLMQPDCNASRTVIYTGMFISTT--FILMFANFYIHNYILNGSKQKS 260
            ||:|:| .:..|:....||..:|:  |..|:..|  |:.:|.|||...|    .|.||
  Fly   212 QFVLIL-GYMLTVGAKGCNMPKTL--TFFFVGNTVIFLYLFGNFYRKTY----KKAKS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 98/250 (39%)
bondNP_651062.3 ELO 27..262 CDD:279492 98/251 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449559
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.