DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG5326

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_651060.1 Gene:CG5326 / 42655 FlyBaseID:FBgn0038983 Length:277 Species:Drosophila melanogaster


Alignment Length:261 Identity:95/261 - (36%)
Similarity:143/261 - (54%) Gaps:30/261 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGL------H 78
            |..:|.|...|:..||.|.|..|.::|.:|||::|:..:..||.:|::.:.|:...|.      |
  Fly    32 LSNAPGPLFMILGAYLYFCLYAGPRYMRDRKPFELKNTLLVYNAVQVLLSWVLFYEGYKGGWGGH 96

  Fly    79 FLFVLKAYDLRCITKLPLDHE------LKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFL 137
                   |:.:|   .|:.:|      ..:|..||   |:..|..:||:|||||||||.||||||
  Fly    97 -------YNFKC---QPVTYESDPISMRMARAVWL---YYIAKITELLDTVFFVLRKKQRQISFL 148

  Fly   138 HVFHHLVMSFGGYLHIT-FNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITI 200
            |::||.:|....::.:. |.|..|||  |..:|..:|:||||||.||::...||... |||||||
  Fly   149 HLYHHTLMPVCAFIGVKYFAGGHGTL--LGFINSFIHIIMYAYYLLSAMGPKVQKYLWWKKYITI 211

  Fly   201 VQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQ-KSALKS 264
            :|:|||:::..:......||:||..:::.....|.:..|..||:.||:.||....:.| |.|.|.
  Fly   212 LQIVQFLIIFVHTLQIQFQPNCNFPKSIAALLTFNAGLFTYMFSAFYVANYKKEAAAQAKLAAKK 276

  Fly   265 D 265
            :
  Fly   277 E 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 92/253 (36%)
CG5326NP_651060.1 ELO 31..262 CDD:395916 89/244 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449602
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.