DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG9458

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_731419.1 Gene:CG9458 / 41214 FlyBaseID:FBgn0037765 Length:264 Species:Drosophila melanogaster


Alignment Length:249 Identity:138/249 - (55%)
Similarity:177/249 - (71%) Gaps:2/249 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLH 78
            |||||||:.|..|.|.:::.||.||...|.|.|.||||:|||.:|:||||||||||.::....:|
  Fly    15 DPVRLPLLASHKPVLMVLATYLFFVKIAGPKIMRNRKPFDLRGLIKAYNIMQIVYNVIMCFFAVH 79

  Fly    79 FLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143
            |:.....|:.:||..||.|||.|:.||||||||||||.:|||||||||||||||||||||||||:
  Fly    80 FMLGPGDYNFKCIKNLPPDHEYKTWERWLTYSYFFNKLLDLLETVFFVLRKKDRQISFLHVFHHM 144

  Fly   144 VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQLVQFI 207
            .|.:..::::.:.||||..|.:|..||.||::||:|||.||:::|.:... ||||||||||:||.
  Fly   145 YMLYFSFMYLYYYGYGGHGFFMCFFNVVVHIMMYSYYYQSSLNRDSKGDLWWKKYITIVQLIQFG 209

  Fly   208 LVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYIL-NGSKQKS 260
            :||.:..|||.||||.::|........||..||::|:|||.|.||. ...|||:
  Fly   210 IVLGHSIYTLKQPDCPSARFSATCAGSISVVFIILFSNFYFHAYIRPKKRKQKN 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 131/241 (54%)
CG9458NP_731419.1 ELO 20..261 CDD:279492 130/240 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449524
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1211.750

Return to query results.
Submit another query.