DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG9459

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649958.2 Gene:CG9459 / 41213 FlyBaseID:FBgn0037764 Length:265 Species:Drosophila melanogaster


Alignment Length:263 Identity:140/263 - (53%)
Similarity:182/263 - (69%) Gaps:5/263 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADLLNGTLIISEDPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQ 65
            |.|.||.:   ..|||||||..|.||.|||:.:||:|:..:|..||:|:|||:|.|.|:.|||:|
  Fly     5 MLDFLNRS---PPDPVRLPLTSSHWPVLTILGIYLVFIKIVGPWFMQNQKPYNLDRAIKIYNIVQ 66

  Fly    66 IVYNGVILIAGLHFLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKK 130
            |.||.::||..:||:.....|:..||:.||||||.|:.||||:|||||||.|||||||||:.|||
  Fly    67 IAYNVILLIFSVHFMLGPGNYNFSCISNLPLDHEYKNWERWLSYSYFFNKLMDLLETVFFIFRKK 131

  Fly   131 DRQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-W 194
            .|||||||||||:.|.:.|:|::.:.||||..|.|...||.||.:||.|||.||::::..... |
  Fly   132 YRQISFLHVFHHVYMVYIGFLYMYYYGYGGHGFFLITFNVVVHTMMYTYYYQSSLNRNSGGDLWW 196

  Fly   195 KKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQK 259
            |||||:||||||:::.::..|.|.|.||..||.....|..||..||::|:|||:..||| ..|.|
  Fly   197 KKYITVVQLVQFVIIFSHSVYILRQTDCQTSRLSATWGSLISVVFIILFSNFYVRTYIL-PKKTK 260

  Fly   260 SAL 262
            ||:
  Fly   261 SAV 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 128/240 (53%)
CG9459NP_649958.2 ELO 20..261 CDD:279492 128/241 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449526
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.