DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and ELOVL

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_649754.1 Gene:ELOVL / 40943 FlyBaseID:FBgn0037534 Length:329 Species:Drosophila melanogaster


Alignment Length:275 Identity:94/275 - (34%)
Similarity:145/275 - (52%) Gaps:57/275 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFV- 82
            ||:.||:|::.|...|...|..||.|.||||||::||:|:..||..|::::.        :||. 
  Fly    27 PLMSSPFPTIAISLTYAYIVKVLGPKLMENRKPFELRKVLIVYNAAQVIFSA--------WLFYE 83

  Fly    83 ------LKAYDLRCITKLPLDHE-----LKSRER--WLTYSYFFNKFMDLLETVFFVLRKKDRQI 134
                  |..|:|||   .|:::.     :::.|.  |    |:|:||.:..:|.|||:||:..|:
  Fly    84 SCIGGWLNGYNLRC---EPVNYSYSPKAIRTAEGCWW----YYFSKFTEFFDTFFFVMRKRYDQV 141

  Fly   135 SFLHVFHHLVMSF----------GGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDV 189
            |.|||.||.:|..          ||  |.||.|:         ||..||:.|||||.|:::...|
  Fly   142 STLHVIHHGIMPVSVWWGVKFTPGG--HSTFFGF---------LNTFVHIFMYAYYMLAAMGPKV 195

  Fly   190 QTSR-WKKYITIVQLVQFILVLANFSYTLMQPDCNASRTVIYTGMFI---STTFILMFANFYIHN 250
            |... ||||:|::|::||:||:.:......:.|||......|   ||   :..|..:|:|||...
  Fly   196 QKYLWWKKYLTVMQMIQFVLVMVHSFQLFFKNDCNYPIGFAY---FIGAHAVMFYFLFSNFYKRA 257

  Fly   251 YILNGSKQKSALKSD 265
            |:....|.|:::|::
  Fly   258 YVKRDGKDKASVKAN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 92/267 (34%)
ELOVLNP_649754.1 ELO 27..266 CDD:366492 92/267 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449614
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.