DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Baldspot

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_648909.1 Gene:Baldspot / 39860 FlyBaseID:FBgn0260960 Length:316 Species:Drosophila melanogaster


Alignment Length:239 Identity:64/239 - (26%)
Similarity:114/239 - (47%) Gaps:31/239 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 LYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGL-----HFLFVLKAYDLRCIT 92
            :|:|.:.. |:.||:||..:.||..:..:|.:..:::    |.|.     ..:.||:.|.|....
  Fly    44 IYMLVIFG-GQHFMQNRPRFQLRGPLIIWNTLLAMFS----IMGAARTAPELIHVLRHYGLFHSV 103

  Fly    93 KLPLDHELKSRER----WLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLVMSFGGYLHI 153
            .:|...|   ::|    | |:.:..:|..:|.:|:|.||||  :.:.|||.:||:.:..  |...
  Fly   104 CVPSYIE---QDRVCGFW-TWLFVLSKLPELGDTIFIVLRK--QPLIFLHWYHHITVLI--YSWF 160

  Fly   154 TFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRW-KKYITIVQLVQFIL-----VLAN 212
            ::..|..:.....::|..||.:||:||.|.:..  ....|: ...||.:||.|.|:     |.||
  Fly   161 SYTEYTSSARWFIVMNYCVHSVMYSYYALKAAR--FNPPRFISMIITSLQLAQMIIGCAINVWAN 223

  Fly   213 -FSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNG 255
             |..|.....|:.|:..|...:.:.:::.::||.|:...|:..|
  Fly   224 GFLKTHGTSSCHISQRNINLSIAMYSSYFVLFARFFYKAYLAPG 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 64/239 (27%)
BaldspotNP_648909.1 ELO 30..271 CDD:395916 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45473077
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46589
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.750

Return to query results.
Submit another query.