DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG17821

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_725820.2 Gene:CG17821 / 37159 FlyBaseID:FBgn0034383 Length:262 Species:Drosophila melanogaster


Alignment Length:261 Identity:110/261 - (42%)
Similarity:161/261 - (61%) Gaps:5/261 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADLLNGTLIISEDPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQ 65
            :.||..|   :..|||.||:.|:|.|::.||..|||.:.|:|..||.:||||::|:.:..||..|
  Fly     5 LLDLFRG---LPADPVHLPMFGTPLPAIVIVLGYLLLIFKVGPDFMRSRKPYNMRKAMLIYNFCQ 66

  Fly    66 IVYNGVILIAGLHFLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKK 130
            ::.|..|.:.|.::||:.|.||.||:|.|..||..|..:|.|||.||.||.:||::|:||||||.
  Fly    67 VLMNSGIFLMGTYYLFIKKLYDFRCMTMLSSDHPDKDVDRLLTYFYFINKVIDLIDTIFFVLRKS 131

  Fly   131 DRQISFLHVFHHLVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQ-TSRW 194
            ::||:.|||:||:.|..|..|...|.|.||....:..||..|||:|||||:.|:...:|: |..|
  Fly   132 NKQITVLHVYHHVFMVLGVPLTYYFYGPGGQYNLMGYLNSFVHVVMYAYYFASAWYPNVKSTFWW 196

  Fly   195 KKYITIVQLVQFILVLANFSYTL-MQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQ 258
            |:|||.:|.:||:::.|....|| :.|.|...:.:.|..:..|.:.:.||.|||...|:...||:
  Fly   197 KEYITKLQFLQFMILFAQSVLTLWLNPGCRFPKVLQYVQLGGSVSMMTMFGNFYYQTYVKAKSKE 261

  Fly   259 K 259
            :
  Fly   262 Q 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 103/241 (43%)
CG17821NP_725820.2 ELO 20..262 CDD:279492 103/241 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449543
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.