DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG18609

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_611365.2 Gene:CG18609 / 37158 FlyBaseID:FBgn0034382 Length:263 Species:Drosophila melanogaster


Alignment Length:241 Identity:113/241 - (46%)
Similarity:153/241 - (63%) Gaps:2/241 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLH 78
            ||..:||.|||||...|:..|||||||||:.||.|||||||:.|::.||:.|::|||:......:
  Fly    11 DPNPIPLAGSPWPITLILIAYLLFVLKLGKIFMRNRKPYDLKTVLKVYNLFQVLYNGLYFGMVFY 75

  Fly    79 FLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143
            :||::...:|.||...|..||.|..||.|..:|..||.:||::||||||||..:||:|||::||:
  Fly    76 YLFIVGICNLHCIESFPEGHERKQLERVLHAAYLLNKVLDLMDTVFFVLRKSYKQITFLHIYHHV 140

  Fly   144 VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTS-RWKKYITIVQLVQFI 207
            .||||.|....:.|.||.:..:.|||..||.:||.||:|||....|:.: .||||||:.||.||.
  Fly   141 FMSFGSYALTRYYGTGGHVNAVGLLNSLVHTVMYFYYFLSSEYPGVRANIWWKKYITLTQLCQFF 205

  Fly   208 LVLANFSYT-LMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYI 252
            ::|:...|. ...|:|...|.::|..|.....||.:|..|||.||:
  Fly   206 MLLSYAIYVRFFSPNCGVPRGLLYLNMVQGVVFIYLFGKFYIDNYL 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 111/236 (47%)
CG18609NP_611365.2 ELO 16..257 CDD:279492 111/236 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449537
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 1 0.950 - 0 Normalized mean entropy S1820
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1211.750

Return to query results.
Submit another query.