DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elovl7b

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_956072.1 Gene:elovl7b / 327274 ZFINID:ZDB-GENE-030131-5485 Length:282 Species:Danio rerio


Alignment Length:244 Identity:95/244 - (38%)
Similarity:135/244 - (55%) Gaps:24/244 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVL- 83
            |:|||:|...|::.|:.||..||.:.||||||:.|:..:       |:||..|::..|:.::.. 
Zfish    30 LMGSPFPQTFIIAAYVFFVTTLGPRLMENRKPFQLKNTM-------IIYNLSIVLFSLYMIYEFL 87

  Fly    84 -----KAYDLRCITKLPLDHELKS---RERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVF 140
                 ..|..||..   :|:....   |..|..:.|:|:||:::|:|||||||||..|:|||||:
Zfish    88 MSGWANGYTYRCDL---VDYSSSPQALRMAWTCWLYYFSKFIEMLDTVFFVLRKKSSQVSFLHVY 149

  Fly   141 HHLVMSFGGYLHITFNGYG-GTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR-WKKYITIVQL 203
            ||.:|.|..:..:.|...| ||..  .|||..||||||:||.||::....|... ||||:|.:||
Zfish   150 HHSIMPFTWWFGVRFAPGGLGTFH--ALLNCIVHVIMYSYYLLSALGPKYQKYLWWKKYMTTIQL 212

  Fly   204 VQFILVLANFSYTLMQPDCNASRTV-IYTGMFISTTFILMFANFYIHNY 251
            |||:||.|:........||.....| :|........|:|:|.:||.|.|
Zfish   213 VQFVLVTAHIGQFFFMQDCPYQFPVFLYIIGLYGLIFLLLFLHFYYHAY 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 95/244 (39%)
elovl7bNP_956072.1 ELO 30..228 CDD:279492 84/209 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.020

Return to query results.
Submit another query.