DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG31523

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001262255.1 Gene:CG31523 / 326148 FlyBaseID:FBgn0051523 Length:354 Species:Drosophila melanogaster


Alignment Length:255 Identity:77/255 - (30%)
Similarity:140/255 - (54%) Gaps:20/255 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 LIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLK 84
            |:.||.|:|.:...|..|...||.:.|..|||.:||.|:..||.:|.:::     |.:.:.:::.
  Fly    29 LLSSPLPTLCMCIFYAYFSKSLGPRLMAKRKPMELRSVLVVYNAIQTIFS-----AWIFYEYLMS 88

  Fly    85 A----YDLRCITKLPLDHE---LKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHH 142
            .    |.|:|   .|:|:.   |..|...:.:.|:.:||.:..:|:||:||||:..:|.|||.||
  Fly    89 GWWGHYSLKC---QPVDYSTTGLAMRMVNICWWYYISKFTEFFDTLFFILRKKNEHVSTLHVIHH 150

  Fly   143 LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQT-SRWKKYITIVQLVQF 206
            ..|.|..::.:.|...|.:.| ..|||..||::||.||.::::....|. ..||||:|..|:|||
  Fly   151 GCMPFSVWMGLKFAPGGHSTF-FALLNSFVHIVMYFYYMIAAMGPKYQKYIWWKKYLTTFQMVQF 214

  Fly   207 ILVLANFSYTLMQPDCNASR-TVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            :.:..: .:.|:..:|:..: .:::.|:. ...|:.:|::||...|:....:::.|:|::
  Fly   215 VAIFTH-QFQLLFRECDYPKGFMVWIGLH-GVMFLFLFSDFYKAKYLNAARRRRQAVKAN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 75/247 (30%)
CG31523NP_001262255.1 ELO 28..265 CDD:279492 75/246 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449615
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - otm3414
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
109.900

Return to query results.
Submit another query.