DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and CG31141

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_732912.2 Gene:CG31141 / 318605 FlyBaseID:FBgn0051141 Length:253 Species:Drosophila melanogaster


Alignment Length:239 Identity:118/239 - (49%)
Similarity:166/239 - (69%) Gaps:3/239 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 DPVRLPLIGSPWPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLH 78
            |..:|||...|.|.:.|:..|||.|.|.||||||:|:||:||:|::.||:.||.||.::|:.|.:
  Fly    11 DSKQLPLATGPGPIIIILIGYLLVVFKAGRKFMEHREPYNLRKVLKYYNMFQIFYNIMMLLPGYY 75

  Fly    79 FLFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143
            |:.|.:.|:.||:|.|..||.||:.||.::|:|:.||.:|||:|||.|||||..||:|||||||:
  Fly    76 FMLVFQPYNFRCMTVLQQDHPLKNWERCISYAYYINKIVDLLDTVFCVLRKKYSQITFLHVFHHV 140

  Fly   144 VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFIL 208
            :|...|||.|.|.||||.||.||..||.||:.|||||| |::..:  |.|||:|:|::|::||:|
  Fly   141 LMPSAGYLIIRFYGYGGQLFFLCSFNVFVHIFMYAYYY-SAIKGN--TVRWKRYLTLMQMLQFLL 202

  Fly   209 VLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYI 252
            :..:.:.|.||..|.||:..::.....:|...:||||||...|:
  Fly   203 MFGHCALTAMQRQCTASQGTLFLVSCSATIMFIMFANFYFQCYL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 116/234 (50%)
CG31141NP_732912.2 ELO 34..253 CDD:279492 108/216 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449533
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I1459
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 1 0.900 - - OOG6_100813
Panther 1 1.100 - - P PTHR11157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
1110.800

Return to query results.
Submit another query.