DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl3

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001101072.1 Gene:Elovl3 / 309449 RGDID:1307263 Length:271 Species:Rattus norvegicus


Alignment Length:261 Identity:65/261 - (24%)
Similarity:120/261 - (45%) Gaps:34/261 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 PLIGSPW-PSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHF--- 79
            |.:...| .|..||.:|||.:: .|:.:|:.||.:.|:|.:..::....:::   ::..|..   
  Rat    29 PFLEEYWVSSFFIVLVYLLLII-FGQNYMKTRKGFSLQRPLILWSFCLAIFS---ILGTLRMWKF 89

  Fly    80 ----LFVLKAYDLRCITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVF 140
                ||.:......|.|....|..:|.   | ::.:..:|.::|.:|.|.:|||  |.:.|:|.:
  Rat    90 MGTVLFTMGLKQTVCFTDYTNDAIVKF---W-SWVFLLSKVVELGDTAFIILRK--RPLIFVHWY 148

  Fly   141 HH----LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIV 201
            ||    |..|||....:...|:..|      :|:.||.:||.||.:.: :|....:.....||.:
  Rat   149 HHSTVLLFTSFGYKNKVPSGGWFMT------MNLGVHSVMYTYYTMKA-AKVKHPNILPMVITSL 206

  Fly   202 QLVQFIL--VLANFSYTLMQP-DCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALK 263
            |::|.:|  :....:|...|. .|..:....:....:..|:.::||.|:...|:  ..|:|:..|
  Rat   207 QILQMVLGTIFGILNYIWRQERGCYTTSEHFFWSFVLYGTYFILFAQFFHRAYL--RPKRKAESK 269

  Fly   264 S 264
            |
  Rat   270 S 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 62/254 (24%)
Elovl3NP_001101072.1 ELO 30..266 CDD:279492 61/254 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.