DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elo-8

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001255110.1 Gene:elo-8 / 259739 WormBaseID:WBGene00001246 Length:292 Species:Caenorhabditis elegans


Alignment Length:144 Identity:43/144 - (29%)
Similarity:63/144 - (43%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   113 FNKFMDLLETVFFVLRKKDRQISFLHVFHH-LVMSFGGYLHITFNGYGGTLFP-LCLLNVAVHVI 175
            |.|.:|||||:  :|....|:...:|:.|| |.:||.    .||......|.. :...|:..||.
 Worm    98 FTKVVDLLETM--LLLYDARRPLTIHIIHHFLSLSFA----FTFYSQNFALHRWIVFFNLTAHVF 156

  Fly   176 MYAYYYLSSVSKDVQTSRWKKYITIV---QLVQFIL-VLANFSYT---LMQPDCNASRTVIYTGM 233
            :|||     :|.....:||......|   |::|.|| .:|.||..   .....|:|:...:.|..
 Worm   157 LYAY-----LSGFKILNRWTPCWVAVCSSQMLQLILPFIATFSAAAKLARGTRCDANALGLLTLQ 216

  Fly   234 FISTTFILMFANFY 247
            ......|::||.||
 Worm   217 IGLGVLIILFAEFY 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 43/144 (30%)
elo-8NP_001255110.1 ELO 14..243 CDD:295675 43/144 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.