DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and SPAC1B2.03c

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_593930.1 Gene:SPAC1B2.03c / 2542505 PomBaseID:SPAC1B2.03c Length:334 Species:Schizosaccharomyces pombe


Alignment Length:283 Identity:87/283 - (30%)
Similarity:144/283 - (50%) Gaps:58/283 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 PVRLPLIGSPWPSLTIVSLYLLFVLKL-GRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLH 78
            |.:.|:  |.|.|: |||:...:|:.| ||..|.||||...||:.:.:|.:..:.:|.:|...:.
pombe    47 PGKTPM--SQWSSV-IVSITAYYVIILSGRAIMTNRKPLKQRRLFQLHNFILTIISGALLALLVE 108

  Fly    79 FLFVLKAY----------DLRCITKLPLDHELKSRERWLTYSY--FFNKFMDLLETVFFVLRKKD 131
            .:|  :.|          |.|..|           :|.:|..|  :..|:::|::|||..|:|| 
pombe   109 EVF--RNYMRNGLFYCVCDSRHFT-----------QRLVTLYYLNYLTKYLELMDTVFLFLKKK- 159

  Fly   132 RQISFLHVFHH---LVMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSR 193
             .::|||.:||   .::.|...|..|...:|     :..||:.||||||:||:|::..:.|.   
pombe   160 -PLAFLHCYHHGITALLCFTQLLGRTSVQWG-----VIGLNLYVHVIMYSYYFLAACGRRVW--- 215

  Fly   194 WKKYITIVQLVQFILVL----------ANFSYTLMQP---DCNASRTVIYTGMFISTTFILMFAN 245
            ||:::|.||::||:|.|          ..|.|....|   ||:.|....:.|..:.::::.:|..
pombe   216 WKQWVTRVQIIQFVLDLILCYFGTYSHIAFRYFPWLPHVGDCSGSLFAAFFGCGVLSSYLFLFIG 280

  Fly   246 FYIHNYILNGSK---QKSALKSD 265
            |||:.||..|:|   :|:|.|:|
pombe   281 FYINTYIKRGAKKNQRKAAGKAD 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 82/271 (30%)
SPAC1B2.03cNP_593930.1 ELO 50..294 CDD:279492 82/269 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 108 1.000 Domainoid score I1638
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 111 1.000 Inparanoid score I1568
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 1 1.000 - - mtm9256
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
TreeFam 00.000 Not matched by this tool.
76.860

Return to query results.
Submit another query.