DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elo-7

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_001255397.1 Gene:elo-7 / 186426 WormBaseID:WBGene00001245 Length:309 Species:Caenorhabditis elegans


Alignment Length:252 Identity:65/252 - (25%)
Similarity:119/252 - (47%) Gaps:43/252 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLKAYDLR--- 89
            :.|..:.|:|.:|   :||.:|:|:.|...:|.:|....|::    |.|...:|......:|   
 Worm    72 MAIAYVILVFSIK---RFMRDREPFQLTTALRLWNFFLSVFS----IYGSWTMFPFMVQQIRLYG 129

  Fly    90 -------CITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL---V 144
                   .::.||     ...|.|| :....:|.::.::|.|.|||||  .:.|||.:||:   |
 Worm   130 LYGCGCEALSNLP-----SQAEYWL-FLTILSKAVEFVDTFFLVLRKK--PLIFLHWYHHMATFV 186

  Fly   145 MSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFILV 209
            .....|...:.....|.     ::|:.||..||.||:..|::..| .::....:|::||.||:..
 Worm   187 FFCSNYPTPSSQSRVGV-----IVNLFVHAFMYPYYFTRSMNIKV-PAKISMAVTVLQLTQFMCF 245

  Fly   210 LANFSYTLM-------QPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQK 259
            :  :..|||       |..|:....|:::...:|:::.::||||:...|:..|.|::
 Worm   246 I--YGCTLMYYSLATNQYTCDTPMFVLHSTFALSSSYFVLFANFFHKAYLQRGGKRE 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 65/250 (26%)
elo-7NP_001255397.1 ELO 61..299 CDD:279492 64/249 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.