DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and elo-6

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_500797.1 Gene:elo-6 / 177321 WormBaseID:WBGene00001244 Length:274 Species:Caenorhabditis elegans


Alignment Length:278 Identity:77/278 - (27%)
Similarity:119/278 - (42%) Gaps:84/278 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 WPSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLKAYDLR 89
            |.|:..|  .::|.||   ..|.||||:||...:..:|            |||.....|.:    
 Worm    35 WISMAYV--VVIFGLK---AVMTNRKPFDLTGPLNLWN------------AGLAIFSTLGS---- 78

  Fly    90 CITKLPLDHELKSR---ERWLTYSYFFN-------------KFMDLLETVFFVLRKKDRQISFLH 138
            ..|...|.||..||   |.::....|:|             |..:..:|:|.:||||  .:.|||
 Worm    79 LATTFGLLHEFFSRGFFESYIHIGDFYNGLSGMFTWLFVLSKVAEFGDTLFIILRKK--PLMFLH 141

  Fly   139 VFHHLV------MSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRW-KK 196
            .:||::      |||..  ::.||.:      :..:|.:||.|||.||.|.|..  |:...| .|
 Worm   142 WYHHVLTMNYAFMSFEA--NLGFNTW------ITWMNFSVHSIMYGYYMLRSFG--VKVPAWIAK 196

  Fly   197 YITIVQLVQFIL---VLANFSYTLMQPDCNASRTVIYTGMFISTT-------------FILMFAN 245
            .||.:|::||::   :|.:..|            :..||..:.:|             ::::|.|
 Worm   197 NITTMQILQFVITHFILFHVGY------------LAVTGQSVDSTPGYYWFCLLMEISYVVLFGN 249

  Fly   246 FYIHNYILNGSKQKSALK 263
            ||..:||..|.|:.:|.|
 Worm   250 FYYQSYIKGGGKKFNAEK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 75/272 (28%)
elo-6NP_500797.1 ELO 33..262 CDD:279492 74/271 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.720

Return to query results.
Submit another query.