DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl6

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_599210.1 Gene:Elovl6 / 171402 RGDID:620585 Length:267 Species:Rattus norvegicus


Alignment Length:258 Identity:65/258 - (25%)
Similarity:122/258 - (47%) Gaps:42/258 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 SLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYN--GVILIAGLHFLFVLKAYDLR 89
            |....:||..|:.. ||..|..|..::||:.:..:::...|::  |. |..|.:.|::|....|:
  Rat    33 SFLFSALYAAFIFG-GRHLMNKRAKFELRKPLVLWSLTLAVFSIFGA-LRTGAYMLYILMTKGLK 95

  Fly    90 ---C--------ITKLPLDHELKSRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHL 143
               |        ::|.           | .|::..:|..:|.:|:|.:|||  :::.|||.:||:
  Rat    96 QSVCDQSFYNGPVSKF-----------W-AYAFVLSKAPELGDTIFIILRK--QKLIFLHWYHHI 146

  Fly   144 -VMSFGGYLHITFNGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQLVQFI 207
             |:.:..|.:......||...   .:|..||.:||:||.|.:....| :.::..:||:.|:.|.:
  Rat   147 TVLLYSWYSYKDMVAGGGWFM---TMNYGVHAVMYSYYALRAAGFRV-SRKFAMFITLSQITQML 207

  Fly   208 L--VLANFSYTLMQPD---CNASRTVIYTGMFISTTFILMFANFYIHNYILNGSKQKSALKSD 265
            :  |:....:..||.|   |.:....|:....:..:::|:|.:|:...||   .|.|.|.|::
  Rat   208 MGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFEAYI---GKVKKATKAE 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 62/250 (25%)
Elovl6NP_599210.1 ELO 25..264 CDD:395916 63/253 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100813
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.