DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8534 and Elovl5

DIOPT Version :9

Sequence 1:NP_649955.1 Gene:CG8534 / 41210 FlyBaseID:FBgn0037761 Length:265 Species:Drosophila melanogaster
Sequence 2:NP_599209.1 Gene:Elovl5 / 171400 RGDID:620583 Length:299 Species:Rattus norvegicus


Alignment Length:257 Identity:86/257 - (33%)
Similarity:134/257 - (52%) Gaps:42/257 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 PSLTIVSLYLLFVLKLGRKFMENRKPYDLRRVIRAYNIMQIVYNGVILIAGLHFLFVLKA----- 85
            |:....::|||.|. ||.|:|:||:|:..|.::..||:      |:.|:: |:..:.|..     
  Rat    34 PTFVCSAIYLLIVW-LGPKYMKNRQPFSCRGILVVYNL------GLTLLS-LYMFYELVTGVWEG 90

  Fly    86 -YDLRCI-TKLPLDHELK-SRERWLTYSYFFNKFMDLLETVFFVLRKKDRQISFLHVFHHLVMSF 147
             |:..|. |:...:.::| .|..|.   |:|:|.::.::|.||:|||.:.||:.|||:||..|  
  Rat    91 KYNFFCQGTRSAGESDMKVIRVLWW---YYFSKLIEFMDTFFFILRKNNHQITVLHVYHHATM-- 150

  Fly   148 GGYLHITF----------NGYGGTLFPLCLLNVAVHVIMYAYYYLSSVSKDVQTSRWKKYITIVQ 202
               |:|.:          :.:|.|      ||..:||:||:||.||||........||||||..|
  Rat   151 ---LNIWWFVMNWVPCGHSYFGAT------LNSFIHVLMYSYYGLSSVPSMRPYLWWKKYITQGQ 206

  Fly   203 LVQFILVLANFSYTLMQPDCNASRTVIYTGMFISTTFILMFANFYIHNYILNG-SKQKSALK 263
            ||||:|.:...|..::.| |:.....:|..:....:.|.:|.||||..|...| |::|..||
  Rat   207 LVQFVLTIIQTSCGVIWP-CSFPLGWLYFQIGYMISLIALFTNFYIQTYNKKGASRRKEHLK 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8534NP_649955.1 ELO 19..259 CDD:366492 83/251 (33%)
Elovl5NP_599209.1 ELO 27..261 CDD:395916 82/249 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3071
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1094172at2759
OrthoFinder 1 1.000 - - FOG0000078
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X54
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.