DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and AT5G21900

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_680178.1 Gene:AT5G21900 / 832250 AraportID:AT5G21900 Length:544 Species:Arabidopsis thaliana


Alignment Length:230 Identity:46/230 - (20%)
Similarity:76/230 - (33%) Gaps:83/230 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   957 NEIFDNAMAGVWIKTDSNPTLKRNKIYDGRDGGICIFNGGKGILEENDIFRNTQAGVLISTQSHP 1021
            |:.|..|..|.       |:|....:    .|..|:                |...:|:.::|.|
plant   244 NQFFKRAPNGF-------PSLTTLSL----QGAFCL----------------TDNALLLISKSSP 281

  Fly  1022 ILRRNRIYDGQAAGVEITNNATATLEHNQIFKNKFG----GLCLASGVQPITRGNNIFNNEDEVE 1082
            :|:.          :.:|..:..|....:|..:|||    ||.: .|.|.|.:           .
plant   282 LLQY----------INLTECSLLTYRALRILADKFGSTLRGLSI-GGCQGIKK-----------H 324

  Fly  1083 KAVSSGQCLYKIS--SYTSFP---------MHDFYRCQTCNTTDRNAICVNCIKNCHAGHDVEFI 1136
            |..||.  |||..  :|.|..         :..|:..::...||.:      :.||:...| |.:
plant   325 KGFSSS--LYKFEKLNYLSVAGLVSVNDGVVRSFFMFRSSILTDLS------LANCNEVTD-ECM 380

  Fly  1137 RHDRFFCDCGAGTLSNQCQLQGEPTQDTDTLYDSA 1171
            .|...:|.          :|:.....|.|.|.|.:
plant   381 WHIGRYCK----------KLEALDITDLDKLTDKS 405

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689
Beta_helix 650..796 CDD:289971
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971 24/123 (20%)
ZnF_UBR1 1093..>1146 CDD:197698 12/63 (19%)
AT5G21900NP_680178.1 AMN1 221..405 CDD:187754 46/228 (20%)
leucine-rich repeat 228..244 CDD:275381 46/230 (20%)
leucine-rich repeat 257..282 CDD:275381 6/44 (14%)
leucine-rich repeat 283..309 CDD:275381 7/35 (20%)
leucine-rich repeat 310..354 CDD:275381 13/57 (23%)
AMN1 <357..507 CDD:187754 13/66 (20%)
leucine-rich repeat 364..389 CDD:275381 8/41 (20%)
leucine-rich repeat 390..415 CDD:275381 5/16 (31%)
leucine-rich repeat 416..441 CDD:275381
leucine-rich repeat 442..467 CDD:275381
leucine-rich repeat 468..493 CDD:275381
leucine-rich repeat 494..516 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.