DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and fbxo36a

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001070215.1 Gene:fbxo36a / 767780 ZFINID:ZDB-GENE-060929-986 Length:189 Species:Danio rerio


Alignment Length:87 Identity:27/87 - (31%)
Similarity:40/87 - (45%) Gaps:13/87 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 YLQYELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKRLYQSVFEYDLPLFNPELCKF 430
            ||: .|||::||.|.||:..||:..|:....||..:.|..|:||:   :|..:         |..
Zfish    93 YLE-RLPDKLLLTILSYISLQDIGHLSQTSNRFRKLCNSEEIWKK---TVLGH---------CDG 144

  Fly   431 VFEKPEESEYANPWKESFRQLY 452
            :.|..|.......||:.|...|
Zfish   145 ITEDMEMLAKVMGWKKIFFGFY 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 17/43 (40%)
Beta_helix 650..796 CDD:289971
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
fbxo36aNP_001070215.1 F-box-like 94..136 CDD:289689 17/42 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1777
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.