DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and fbxo36b

DIOPT Version :10

Sequence 1:NP_649954.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001038863.1 Gene:fbxo36b / 751684 ZFINID:ZDB-GENE-060825-271 Length:179 Species:Danio rerio


Alignment Length:40 Identity:12/40 - (30%)
Similarity:23/40 - (57%) Gaps:0/40 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKR 410
            ||:.:|..|..||..:::..|:..|::|..:.|..|.|::
Zfish    78 LPNALLFKIMGYLDLENISVLSRTCRKFRELCNSEEFWEQ 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_649954.1 F-box_FBXO11 368..412 CDD:438863 12/40 (30%)
Beta_helix 650..798 CDD:463811
Beta_helix 735..890 CDD:463811
Beta_helix 919..1075 CDD:463811
UBR-box_UBR6_FBXO11 1090..1158 CDD:439074
fbxo36bNP_001038863.1 F-box_SF 77..119 CDD:459239 12/40 (30%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.