| Sequence 1: | NP_649954.1 | Gene: | FBXO11 / 41209 | FlyBaseID: | FBgn0037760 | Length: | 1182 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001038863.1 | Gene: | fbxo36b / 751684 | ZFINID: | ZDB-GENE-060825-271 | Length: | 179 | Species: | Danio rerio |
| Alignment Length: | 40 | Identity: | 12/40 - (30%) |
|---|---|---|---|
| Similarity: | 23/40 - (57%) | Gaps: | 0/40 - (0%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 371 LPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKR 410 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| FBXO11 | NP_649954.1 | F-box_FBXO11 | 368..412 | CDD:438863 | 12/40 (30%) |
| Beta_helix | 650..798 | CDD:463811 | |||
| Beta_helix | 735..890 | CDD:463811 | |||
| Beta_helix | 919..1075 | CDD:463811 | |||
| UBR-box_UBR6_FBXO11 | 1090..1158 | CDD:439074 | |||
| fbxo36b | NP_001038863.1 | F-box_SF | 77..119 | CDD:459239 | 12/40 (30%) |
| Blue background indicates that the domain is not in the aligned region. | |||||