DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and Fbxo36

DIOPT Version :10

Sequence 1:NP_649954.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_079662.1 Gene:Fbxo36 / 66153 MGIID:1289192 Length:188 Species:Mus musculus


Alignment Length:107 Identity:26/107 - (24%)
Similarity:43/107 - (40%) Gaps:21/107 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 YLQYELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKRLYQSVFEYDLPLFNPELCKF 430
            ||: .|.|.:||.|..||..:|:..|:....:|..:.....||:::.||.            |..
Mouse    93 YLE-RLSDRLLLKIICYLDLEDIASLSQTSSKFEKLCKSDLLWEQIVQST------------CDT 144

  Fly   431 VFEKPEESEYAN--PWKESFR----QLYRGVHVRPGYQERRS 466
            :  .|:....|.  .|::.|.    ||.|....:...||.::
Mouse   145 I--TPDMRALAKNMGWRQMFLTNNIQLQRQTRKKKQRQENQA 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_649954.1 F-box_FBXO11 368..412 CDD:438863 12/43 (28%)
Beta_helix 650..798 CDD:463811
Beta_helix 735..890 CDD:463811
Beta_helix 919..1075 CDD:463811
UBR-box_UBR6_FBXO11 1090..1158 CDD:439074
Fbxo36NP_079662.1 F-box_FBXO36 94..139 CDD:438878 13/45 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.