DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and fbxl3

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001016128.1 Gene:fbxl3 / 548882 XenbaseID:XB-GENE-1014531 Length:433 Species:Xenopus tropicalis


Alignment Length:391 Identity:81/391 - (20%)
Similarity:136/391 - (34%) Gaps:100/391 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 AGTAASGGAGCAPTAAQYLQYELPD------------EVLLAIFSYLMEQDLCRLALVCKRFNTI 401
            ||.:.|...|..|..|:..:...|:            :::|.||.||...|....:.||:.:|.:
 Frog    10 AGISFSKDIGEVPKKAKNTESGPPEMSKSHDWGNLLPDIILQIFQYLPLLDRAHASQVCRNWNHV 74

  Fly   402 ANDTELWK----RLYQSVFEYDLPLFNPELCKFV------------FEKPEESEYANPWKESFRQ 450
            .:..:||:    .|.|....| |...:|:|.|.:            |:.....|.|....:...|
 Frog    75 FHMPDLWRCFEFELNQPATSY-LNATHPDLIKQIIKRHSNHLQYVSFKVDSSKESAEAACDILSQ 138

  Fly   451 LYR------GV--HVRPGYQERRS----SGRSIVFFNTIQAAL----DYPEERAAAGVFVPAGAG 499
            |..      |:  ..||.:.:...    |..::||.|:...:.    |.|.:..:..|.|     
 Frog   139 LVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKIDDTPVDDPSLKVLV----- 198

  Fly   500 AGNVVSAGLSNTSASAGVGGASV-----------NALVNIY--EEQVAPTEHPGPLIFLHA-GHY 550
            |.|..:..|...|:...|..|.:           ...:|.|  .:::        ||.|.: .|.
 Frog   199 ANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYYLLSDEL--------LIALSSEKHV 255

  Fly   551 KGEYLFIDSDVALVGAAPGNVAESVILEREAGSTVMFVEGAKYAYVGYLTL---KFSP--EVTST 610
            :.|:|.||    :|...||......|  :::....:.....|...|.|..|   :|.|  ...:.
 Frog   256 RLEHLRID----VVSENPGQTQFHTI--QKSSWDALIKHSPKVNLVMYFFLYEEEFDPFFRYETP 314

  Fly   611 VSHHKHYCLDIGENCSPTVDNCI-IRSTSVVGAAVCVGGVNA--NPVIRNCD---------ISDC 663
            |:|     |..|.:.|..|...: :....:|...||..|:..  ..:||..:         :.:|
 Frog   315 VTH-----LYFGRSVSKEVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKSLTAIGLGEC 374

  Fly   664 E 664
            |
 Frog   375 E 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 13/59 (22%)
Beta_helix 650..796 CDD:289971 4/26 (15%)
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
fbxl3NP_001016128.1 F-box-like 41..82 CDD:403981 10/40 (25%)
leucine-rich repeat 179..204 CDD:275381 6/29 (21%)
leucine-rich repeat 205..230 CDD:275381 4/24 (17%)
leucine-rich repeat 231..256 CDD:275381 6/32 (19%)
leucine-rich repeat 257..293 CDD:275381 9/41 (22%)
leucine-rich repeat 294..338 CDD:275381 11/48 (23%)
leucine-rich repeat 339..365 CDD:275381 6/25 (24%)
leucine-rich repeat 366..391 CDD:275381 2/10 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.