DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment FBXO11 and FipoQ

DIOPT Version :9

Sequence 1:	NP_001262441.1	Gene:	FBXO11 / 41209	FlyBaseID:	FBgn0037760	Length:	1182	Species:	Drosophila melanogaster
Sequence 2:	NP_733291.1	Gene:	FipoQ / 43475	FlyBaseID:	FBgn0039667	Length:	515	Species:	Drosophila melanogaster

Alignment Length:	58	Identity:	28/58 - (48%)
Similarity:	40/58 - (68%)	Gaps:	1/58 - (1%)

- Green bases have known domain annotations that are detailed below.

  Fly   354 SGGAGCAPTAAQYLQYELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKRL 411
            |.|...:|.|...:: :|||:|||.|||||..:::||||.:|:|:..||.||.|||.:
  Fly    21 SDGTVRSPFADTTIE-KLPDKVLLHIFSYLSHREICRLARICRRWRQIAYDTRLWKNV 77

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
FBXO11	NP_001262441.1	F-box-like	370..414	CDD:289689	24/42 (57%)
		Beta_helix	650..796	CDD:289971
		Beta_helix	735..882	CDD:289971
		Beta_helix	919..1077	CDD:289971
		ZnF_UBR1	1093..>1146	CDD:197698
FipoQ	NP_733291.1	F-box-like	34..80	CDD:289689	24/45 (53%)
		leucine-rich repeat	131..156	CDD:275381
		leucine-rich repeat	157..175	CDD:275381
		leucine-rich repeat	219..244	CDD:275381
		leucine-rich repeat	245..270	CDD:275381
		leucine-rich repeat	271..295	CDD:275381
		leucine-rich repeat	296..320	CDD:275381
		leucine-rich repeat	321..348	CDD:275381
		leucine-rich repeat	349..375	CDD:275381
		leucine-rich repeat	376..403	CDD:275381
		leucine-rich repeat	405..432	CDD:275381
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	1	1.000	41	1.000	Domainoid score	I4815
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1027299at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	2	2.010