DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and fbxl3a

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001005773.3 Gene:fbxl3a / 378451 ZFINID:ZDB-GENE-030912-5 Length:431 Species:Danio rerio


Alignment Length:399 Identity:92/399 - (23%)
Similarity:144/399 - (36%) Gaps:95/399 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWK----RLYQSVFEYDLPLFNPELCKFV 431
            ||.|:||.||.||...|....:.||..:|...:..|||:    .|.|....| |...:|:|.|.:
Zfish    43 LPQEILLHIFQYLPLLDRAFASQVCHNWNHAFHMPELWRCFEFELNQPATSY-LKATHPDLIKQI 106

  Fly   432 ------------FEKPEESEYANPWKESFRQLYR------GV--HVRPGYQERRS----SGRSIV 472
                        |:....:|.|....:...||..      |:  ..||.:.|...    |..::|
Zfish   107 IKRHSNHLQYVSFKVDSSTESAETACDILSQLVNCSLKTLGLISTARPSFMELPKSHFISALTVV 171

  Fly   473 FFNTIQAAL----DYPEERAAAGVFVPAGAGAGNVVSAGLSNTSASAGVGGASVNALVNIYE--E 531
            |.|:...:.    |.|.:..:..|.|     |.|..:..|...|:...|..|.:..:.:...  .
Zfish   172 FVNSKSLSSLKIDDTPVDDPSLKVLV-----ANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLR 231

  Fly   532 QVAPTEH---PGPLIFLHA-GHYKGEYLFIDSDVALVGAAPGNVAESVILEREAGSTVMFVEGAK 592
            ::|...|   ...|:.|.: .|...|:|.||    :|...||....::   :::....|.....|
Zfish   232 ELALNYHLLSDELLLALSSEKHVHLEHLRID----VVSENPGQQFHTI---KKSSWDAMVRHSPK 289

  Fly   593 YAYVGYLTL---KFSP----EVTSTVSH-------HKHYCLDIGENCSPTV------------DN 631
            :..|.|..|   :|.|    |:  .|:|       .|.....:|.||...|            |.
Zfish   290 FNLVMYFFLYEDEFGPFFRDEI--PVTHLYFGRSVSKEVLGRVGMNCPRLVELVVCANGLRPLDE 352

  Fly   632 CIIRST------SVVGAAVCVGGVNA-NPVIRNC-----DISDCENVGLYVTDYAQGTYE-HNEI 683
            .:||..      |.:|...|....:| ...::.|     .:|..|.|  .:.|:..|..| |.|:
Zfish   353 ELIRIAERCQFLSAIGLGECEVSCSAFVEFVKMCGRRLSQLSIMEEV--LIPDHKYGLDEIHWEV 415

  Fly   684 SRNALAGIW 692
            |:: |..:|
Zfish   416 SKH-LGRVW 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 17/46 (37%)
Beta_helix 650..796 CDD:289971 13/50 (26%)
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
fbxl3aNP_001005773.3 F-box-like 40..81 CDD:315592 15/37 (41%)
leucine-rich repeat 178..203 CDD:275381 6/29 (21%)
leucine-rich repeat 204..229 CDD:275381 4/24 (17%)
leucine-rich repeat 230..255 CDD:275381 5/24 (21%)
leucine-rich repeat 256..291 CDD:275381 9/41 (22%)
leucine-rich repeat 292..336 CDD:275381 12/45 (27%)
leucine-rich repeat 337..363 CDD:275381 4/25 (16%)
leucine-rich repeat 364..389 CDD:275381 5/24 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.