DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and Fbxl21

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001333661.1 Gene:Fbxl21 / 213311 MGIID:2442921 Length:460 Species:Mus musculus


Alignment Length:376 Identity:71/376 - (18%)
Similarity:123/376 - (32%) Gaps:126/376 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   371 LPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKR----LYQSVFEYDLPLFNPELCKFV 431
            ||..|:|.||.||...|..|.:.||:|:|.:.:..:||::    |.||...| ....:|:|.:.:
Mouse    71 LPHHVILQIFQYLPLIDRARASSVCRRWNEVFHIPDLWRKFEFELNQSATSY-FKSTHPDLIQQI 134

  Fly   432 FEK---------------PEESEYA------------------NPWKESFRQLYRGVHVRPGYQE 463
            .:|               .|.:|.|                  :..|.||..:.:...|      
Mouse   135 IKKHAAHLQYVSFKVDSSTESAEAACDILSQLVNCSIQTLGLISTAKPSFMNVPKSHFV------ 193

  Fly   464 RRSSGRSIVFFNTIQAAL----DYPEERAAAGVFVPAGAGAGNVVSAGLSNTSASAGVGGASVNA 524
               |..::||.|:...:.    |.|.:..:..:.|     |.|..:..|...|:...|....:..
Mouse   194 ---SALTVVFVNSKSLSSIKIEDTPVDDPSLKILV-----ANNSDTLRLLKMSSCPHVSSDGILC 250

  Fly   525 LVN-------------IYEEQVAPTEHPGPLIFLHAGHYKGEYLFIDSDVALVGAAPGNVA---- 572
            :.:             |..:::.       |......|...|:|.||    :|...||.:.    
Mouse   251 VADHCQGLRELALNYYILSDEIL-------LALSSETHVNLEHLRID----VVSENPGQIKFHSI 304

  Fly   573 -----ESVILEREAGSTVMFVEGAKYAYVGYLTLKFSPEVTSTVSHHKHYCLD--------IGEN 624
                 :::|......:.||:.    :.|.......|..|...|   |.::...        ||.|
Mouse   305 KKRSWDALIKHSPRVNVVMYF----FLYEEEFEAFFKEETPVT---HLYFGRSVSRAILGRIGLN 362

  Fly   625 CSPTVDNCIIRSTSVVGAAVCVGGV-----NANPVIRNC------DISDCE 664
            |...::           ..||..|:     ....:.::|      .:|:||
Mouse   363 CPRLIE-----------LVVCANGLLPLDSELIRIAKHCKNLTSLGLSECE 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 17/46 (37%)
Beta_helix 650..796 CDD:289971 4/21 (19%)
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
Fbxl21NP_001333661.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.