DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and T28B4.1

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:NP_001024931.1 Gene:T28B4.1 / 180930 WormBaseID:WBGene00020884 Length:552 Species:Caenorhabditis elegans


Alignment Length:465 Identity:98/465 - (21%)
Similarity:154/465 - (33%) Gaps:152/465 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   370 ELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWKRLYQSVFEYDLPLFNPELCKFVFEK 434
            :|||:||..||.||..:.:.::.|||||          |:...|          ||.|.|||   
 Worm    68 KLPDKVLRDIFQYLSPKQINQVGLVCKR----------WRVTSQ----------NPLLWKFV--- 109

  Fly   435 PEESEYANPWKESFRQLYRGVHVRPGYQERRSSGRSIVFFNTIQAALDYPEERAAAGVFVPAGAG 499
                        |||..|.|:.|.|     :.....|....|..:.|...|  .|..:..|    
 Worm   110 ------------SFRPNYGGIQVNP-----QCIDHFIQLIGTRFSELRIVE--LATDLITP---- 151

  Fly   500 AGNVVSAGLSNTSASAGVGGASVNALVNIYEEQVAPTEHPGPL----------IFLHAGHYKGEY 554
              ||:.. |:|.:..........:..:.:::.....: .|..|          |||. |..:..|
 Worm   152 --NVLYE-LANKAPKLQYLTLDFSTAMQLHDFTDLQS-FPSRLKSLTLCLSENIFLE-GFLRKVY 211

  Fly   555 LFIDS--DVALVGAAPGNVAESVILEREAGSTV------MFVEGAKYAY---VGYLTLKFSPEVT 608
            .||.|  .:.::|.......|    |.|...||      .|:...:...   |.::|.:....::
 Worm   212 TFISSVETLHIIGTYEKVEDE----EEEVYETVNVFKLKQFLPNLRVVNLWGVPFITDEHVDAIS 272

  Fly   609 STVSHHK----HYCLDIGENCSPTV-----------------DNCIIR-----STSVVGAAVCVG 647
            |..:|.:    :||..:..:|...|                 ||.|::     .|.:  ..:.:.
 Worm   273 SNCAHLECLCVNYCPKVTGSCLKLVLQRCRKLKTLFLAHTKLDNNIVKMVDWEKTRI--EELDIK 335

  Fly   648 GVNAN-----------PVIRNCDIS--DCENVGLYVTDYAQGTYEHNEISRNALAGIWVKN---- 695
            |...|           |.:|..|.|  :|      :||.....::::    ||:..:...|    
 Worm   336 GTELNSDALISILTRLPHLRWLDASWLEC------MTDQVLEAWQNS----NAMGSLQFLNMDTC 390

  Fly   696 -------FASPIMRENHIHHGRDVGIFTFENG----MGYFEKN---DIHNNRIAGFEVKAGANPT 746
                   ....|.|..|..||..:|      |    :.||..|   .:.|.|:....:.....|.
 Worm   391 DSINEQALVDMIKRHGHQFHGLCLG------GQHKLLEYFWMNMIPQLRNIRVMVMGIAEDCCPK 449

  Fly   747 VVKCEIHHGQ 756
            || .:||..|
 Worm   450 VV-AKIHVDQ 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 15/43 (35%)
Beta_helix 650..796 CDD:289971 29/138 (21%)
Beta_helix 735..882 CDD:289971 6/22 (27%)
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
T28B4.1NP_001024931.1 F-box-like 66..110 CDD:372399 22/76 (29%)
leucine-rich repeat 139..163 CDD:275381 8/32 (25%)
leucine-rich repeat 164..189 CDD:275381 1/25 (4%)
leucine-rich repeat 190..208 CDD:275381 5/18 (28%)
AMN1 <244..358 CDD:187754 17/115 (15%)
leucine-rich repeat 252..277 CDD:275381 3/24 (13%)
leucine-rich repeat 278..303 CDD:275381 4/24 (17%)
leucine-rich repeat 304..353 CDD:275381 6/50 (12%)
leucine-rich repeat 354..381 CDD:275381 8/36 (22%)
leucine-rich repeat 382..431 CDD:275381 11/54 (20%)
leucine-rich repeat 432..469 CDD:275381 8/28 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.