DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment FBXO11 and si:dkey-192l18.9

DIOPT Version :9

Sequence 1:NP_001262441.1 Gene:FBXO11 / 41209 FlyBaseID:FBgn0037760 Length:1182 Species:Drosophila melanogaster
Sequence 2:XP_001344855.1 Gene:si:dkey-192l18.9 / 100005961 ZFINID:ZDB-GENE-120709-25 Length:476 Species:Danio rerio


Alignment Length:211 Identity:49/211 - (23%)
Similarity:68/211 - (32%) Gaps:82/211 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly   240 GASPSSSSSSSS-----SSSSSSSASSSSSSSNVQAPSTS--------ATFPVNNAPTTGATLA- 290
            |:|..||..|||     |.|..::|:|..|..:::.||.:        .|.|.....:.|.|:| 
Zfish    15 GSSSISSDVSSSTEHTPSKSHKNAATSEDSDQSMRTPSPALILNPNPPQTVPNGRESSLGETVAL 79

  Fly   291 --QPPNVHS-SVPQQHCGALPVGAAIEDNNYMLPARKRSRRLYTQGGEMGPSAGATGEAAGAGTA 352
              .||...| |....|...:.:                                           
Zfish    80 IHPPPATRSKSTKPPHTALIDI------------------------------------------- 101

  Fly   353 ASGGAGCAPTAAQYLQYELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWK--RLYQSV 415
                              |||.|||.|.|||....||..|.||:|:..::.|..||.  ||...:
Zfish   102 ------------------LPDPVLLHILSYLSTPHLCLCARVCRRWYNLSWDPRLWSTIRLNGEL 148

  Fly   416 FEYD--LPLFNPELCK 429
            ...|  |.:....||:
Zfish   149 LNADRALKVLTHRLCQ 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
FBXO11NP_001262441.1 F-box-like 370..414 CDD:289689 21/45 (47%)
Beta_helix 650..796 CDD:289971
Beta_helix 735..882 CDD:289971
Beta_helix 919..1077 CDD:289971
ZnF_UBR1 1093..>1146 CDD:197698
si:dkey-192l18.9XP_001344855.1 F-box-like 99..145 CDD:289689 20/106 (19%)
leucine-rich repeat 114..138 CDD:275381 8/23 (35%)
leucine-rich repeat 139..172 CDD:275381 7/26 (27%)
leucine-rich repeat 173..198 CDD:275381
leucine-rich repeat 199..220 CDD:275381
LRR_CC 222..246 CDD:197685
leucine-rich repeat 225..258 CDD:275381
leucine-rich repeat 259..284 CDD:275381
AMN1 280..465 CDD:187754
leucine-rich repeat 285..310 CDD:275381
leucine-rich repeat 311..336 CDD:275381
leucine-rich repeat 337..362 CDD:275381
leucine-rich repeat 363..388 CDD:275381
leucine-rich repeat 389..414 CDD:275381
leucine-rich repeat 415..440 CDD:275381
leucine-rich repeat 441..465 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1027299at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.