Sequence 1: | NP_001262441.1 | Gene: | FBXO11 / 41209 | FlyBaseID: | FBgn0037760 | Length: | 1182 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_001344855.1 | Gene: | si:dkey-192l18.9 / 100005961 | ZFINID: | ZDB-GENE-120709-25 | Length: | 476 | Species: | Danio rerio |
Alignment Length: | 211 | Identity: | 49/211 - (23%) |
---|---|---|---|
Similarity: | 68/211 - (32%) | Gaps: | 82/211 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 240 GASPSSSSSSSS-----SSSSSSSASSSSSSSNVQAPSTS--------ATFPVNNAPTTGATLA- 290
Fly 291 --QPPNVHS-SVPQQHCGALPVGAAIEDNNYMLPARKRSRRLYTQGGEMGPSAGATGEAAGAGTA 352
Fly 353 ASGGAGCAPTAAQYLQYELPDEVLLAIFSYLMEQDLCRLALVCKRFNTIANDTELWK--RLYQSV 415
Fly 416 FEYD--LPLFNPELCK 429 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
FBXO11 | NP_001262441.1 | F-box-like | 370..414 | CDD:289689 | 21/45 (47%) |
Beta_helix | 650..796 | CDD:289971 | |||
Beta_helix | 735..882 | CDD:289971 | |||
Beta_helix | 919..1077 | CDD:289971 | |||
ZnF_UBR1 | 1093..>1146 | CDD:197698 | |||
si:dkey-192l18.9 | XP_001344855.1 | F-box-like | 99..145 | CDD:289689 | 20/106 (19%) |
leucine-rich repeat | 114..138 | CDD:275381 | 8/23 (35%) | ||
leucine-rich repeat | 139..172 | CDD:275381 | 7/26 (27%) | ||
leucine-rich repeat | 173..198 | CDD:275381 | |||
leucine-rich repeat | 199..220 | CDD:275381 | |||
LRR_CC | 222..246 | CDD:197685 | |||
leucine-rich repeat | 225..258 | CDD:275381 | |||
leucine-rich repeat | 259..284 | CDD:275381 | |||
AMN1 | 280..465 | CDD:187754 | |||
leucine-rich repeat | 285..310 | CDD:275381 | |||
leucine-rich repeat | 311..336 | CDD:275381 | |||
leucine-rich repeat | 337..362 | CDD:275381 | |||
leucine-rich repeat | 363..388 | CDD:275381 | |||
leucine-rich repeat | 389..414 | CDD:275381 | |||
leucine-rich repeat | 415..440 | CDD:275381 | |||
leucine-rich repeat | 441..465 | CDD:275381 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1027299at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |