DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9467 and KCTD15

DIOPT Version :9

Sequence 1:NP_001369000.1 Gene:CG9467 / 41207 FlyBaseID:FBgn0037758 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001123466.1 Gene:KCTD15 / 79047 HGNCID:23297 Length:283 Species:Homo sapiens


Alignment Length:170 Identity:46/170 - (27%)
Similarity:75/170 - (44%) Gaps:28/170 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VNLNVGGQRFSTSRQTLTWIPDTFFTALLSGR----ISSLRDEHNAIFIDRDPTLFSIILNYLRT 73
            |:::|||..:::|..|||..||:..:.|.:|.    :.||:..:   |||||..:|..:|::|||
Human    58 VHIDVGGHMYTSSLATLTKYPDSRISRLFNGTEPIVLDSLKQHY---FIDRDGEIFRYVLSFLRT 119

  Fly    74 KDI----DIKNCEIRALRHEAEYYGITPLTKRLALC----EDLNHSSCGDLLFYGFLAAPPMPSN 130
            ..:    |.|:..:  |..||.||.:.|:.:.|...    |....|...|.|.  ....|.:...
Human   120 SKLLLPDDFKDFSL--LYEEARYYQLQPMVRELERWQQEQEQRRRSRACDCLV--VRVTPDLGER 180

  Fly   131 EAVAATS--VDESLPSTSASAIGS-------RPGSMVRVP 161
            .|::...  ::|..|.|......|       .|..::|.|
Human   181 IALSGEKALIEEVFPETGDVMCNSVNAGWNQDPTHVIRFP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9467NP_001369000.1 BTB_POZ_KCTD3-like 10..95 CDD:349672 31/89 (35%)
KCTD15NP_001123466.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
BTB_POZ_KCTD15 55..153 CDD:349696 33/99 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.