DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9467 and CG14647

DIOPT Version :9

Sequence 1:NP_001369000.1 Gene:CG9467 / 41207 FlyBaseID:FBgn0037758 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_649465.6 Gene:CG14647 / 40558 FlyBaseID:FBgn0037244 Length:335 Species:Drosophila melanogaster


Alignment Length:138 Identity:47/138 - (34%)
Similarity:65/138 - (47%) Gaps:25/138 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VNLNVGGQRFSTSRQTLTW-IPDTFFTA--LLSGRIS-SLRDEHNAIFIDRDPTLFSIILNYLR- 72
            |.||||||.::|:..||.. .||:....  |.:|.:. |.|||..|..|||.|..|..|:|||| 
  Fly    36 VKLNVGGQIYATTIDTLVGREPDSMLARMFLQNGSMKPSERDEQGAYLIDRSPRYFEPIINYLRH 100

  Fly    73 TKDIDIKNCEIRALRHEAEYYGI----TPLTKRLALCEDLNHSSCGDLLFYGFLAAPPMPSNEAV 133
            .:.:...|..:..:..||.::||    |.|.:||...|    :..||         .|:..|:.:
  Fly   101 GQFVCDSNISVLGVLEEARFFGIFSLVTHLEERLGQQE----TPLGD---------RPLTRNDVI 152

  Fly   134 AA---TSV 138
            .|   |||
  Fly   153 KAIIQTSV 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9467NP_001369000.1 BTB_POZ_KCTD3-like 10..95 CDD:349672 32/86 (37%)
CG14647NP_649465.6 BTB 35..138 CDD:197585 38/101 (38%)
BTB 36..126 CDD:295341 34/89 (38%)
Pentapeptide_4 160..241 CDD:290330 1/1 (100%)
Pentapeptide 166..202 CDD:279183
Pentapeptide 204..243 CDD:279183
Pentapeptide_4 248..321 CDD:290330
Pentapeptide 249..287 CDD:279183
Pentapeptide 284..322 CDD:279183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.