DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9467 and KCTD1

DIOPT Version :9

Sequence 1:NP_001369000.1 Gene:CG9467 / 41207 FlyBaseID:FBgn0037758 Length:787 Species:Drosophila melanogaster
Sequence 2:NP_001136202.1 Gene:KCTD1 / 284252 HGNCID:18249 Length:865 Species:Homo sapiens


Alignment Length:94 Identity:32/94 - (34%)
Similarity:52/94 - (55%) Gaps:13/94 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VNLNVGGQRFSTSRQTLTWIPDTFFTALLSGR----ISSLRDEHNAIFIDRDPTLFSIILNYLRT 73
            |:::|||..:::|..|||..|::....|..|.    :.||:..:   |||||..:|..|||:|||
Human   640 VHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHY---FIDRDGQMFRYILNFLRT 701

  Fly    74 KDI----DIKNCEIRALRHEAEYYGITPL 98
            ..:    |.|:..:  |..||:|:.:.|:
Human   702 SKLLIPDDFKDYTL--LYEEAKYFQLQPM 728

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9467NP_001369000.1 BTB_POZ_KCTD3-like 10..95 CDD:349672 31/89 (35%)
KCTD1NP_001136202.1 DUF3504 284..439 CDD:288835
BTB 640..735 CDD:197585 32/94 (34%)
BTB 640..732 CDD:295341 32/94 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.