DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8507 and C15C8.4

DIOPT Version :9

Sequence 1:NP_649950.1 Gene:CG8507 / 41205 FlyBaseID:FBgn0037756 Length:379 Species:Drosophila melanogaster
Sequence 2:NP_506187.2 Gene:C15C8.4 / 179745 WormBaseID:WBGene00007606 Length:316 Species:Caenorhabditis elegans


Alignment Length:338 Identity:102/338 - (30%)
Similarity:154/338 - (45%) Gaps:63/338 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 FRMAKLNLVWAKAQNRLTE-PKLKSLYMELKIHDKEEIAWKQLNSQHKDKDGLK-ADELRRKLIG 122
            :|..::|.::.||...:|: ..|..|..||..:|...:|.|   |..:...|.| .|::..||..
 Worm    24 YRTERINFIYEKALQHVTDRQNLARLEKELSGYDAIYLASK---SNRQGTQGTKEIDKIDDKLGK 85

  Fly   123 IMSSYDL----------LEH---FDDTQDTEKLKPYKKFHDAEERHRNKSLFKDKKLNRLWEKAE 174
            |:..|.|          .:|   |..|.|.|.|...|              |.|:.|.:||.:|:
 Worm    86 ILEKYGLEKAVLAFKEKYKHKNLFQQTDDNEPLPSGK--------------FTDQNLQKLWSQAQ 136

  Fly   175 ISGFTAEELKSLKQEFDHHQDKVDVYYSLLENIGTVDTDKHENAINTEDLDTYNLISNDVNENDI 239
            ...|:.:||.:|..|....:.|:.||...|::...|   .|||:           |.:|:.....
 Worm   137 NGKFSQKELNALHGELKEVEQKMRVYEDQLDDFKKV---PHENS-----------IQHDIESIGD 187

  Fly   240 KTHAQNVKSFENDLNTLRGHHTGIKDHYDRLERLVSSGPHSQDFIEPKVQGLWRVAQAS-NFTVK 303
            ||  :.:|:...:||          ||.|.:.|.|:|...| .|.||:|:.||::||.: ..|..
 Worm   188 KT--KKLKAANRELN----------DHLDEVHRKVTSEEFS-PFNEPRVKRLWKLAQENEKLTPH 239

  Fly   304 ELESIKTELHHFESRLLKLRHLHAEHALQKEKYKGEKVKDKSSRFEEMEDQLK--KQTRKVEKLQ 366
            ||..:|.||.||||:|.|: ..|.|...:.::...|:.||||..:|.:|..:|  |..||..||:
 Worm   240 ELSVLKDELSHFESQLKKI-EFHKEEVSRLQEDAEERGKDKSQVYENLELSIKHEKLNRKARKLE 303

  Fly   367 ENIEKTIFKHTEL 379
            :.||:.|..|.||
 Worm   304 KYIEEKIIIHREL 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8507NP_649950.1 Alpha-2-MRAP_N 15..140 CDD:399416 25/94 (27%)
Alpha-2-MRAP_C 161..379 CDD:399417 72/220 (33%)
C15C8.4NP_506187.2 Alpha-2-MRAP_C 123..310 CDD:368884 70/214 (33%)
RAP 218..316 CDD:384230 39/98 (40%)
3-helical coiled coil 223..230 CDD:269812 3/6 (50%)
3-helical coiled coil 240..261 CDD:269812 11/21 (52%)
3-helical coiled coil 294..309 CDD:269812 7/14 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166716
Domainoid 1 1.000 97 1.000 Domainoid score I4567
eggNOG 1 0.900 - - E1_KOG3956
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 108 1.000 Inparanoid score I3488
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG49282
OrthoDB 1 1.010 - - D388256at33208
OrthoFinder 1 1.000 - - FOG0007150
OrthoInspector 1 1.000 - - oto17573
orthoMCL 1 0.900 - - OOG6_107561
Panther 1 1.100 - - LDO PTHR16560
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6462
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1413.840

Return to query results.
Submit another query.