DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and RSR1

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_011668.3 Gene:RSR1 / 853056 SGDID:S000003384 Length:272 Species:Saccharomyces cerevisiae


Alignment Length:229 Identity:84/229 - (36%)
Similarity:128/229 - (55%) Gaps:21/229 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 DYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSHQFPAM 82
            ||::||.||||||||.|.::|::|.:.::|.|||||:||:.|..:..:..|:|.||.|..||.||
Yeast     3 DYKLVVLGAGGVGKSCLTVQFVQGVYLDTYDPTIEDSYRKTIEIDNKVFDLEILDTAGIAQFTAM 67

  Fly    83 QRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELREVSQA 147
            :.|.|..|..|:|||||..:||||||..:...:..:|.:|  .:|::|:|||.|...| |.:|..
Yeast    68 RELYIKSGMGFLLVYSVTDRQSLEELMELREQVLRIKDSD--RVPMVLIGNKADLINE-RVISVE 129

  Fly   148 EGQAQATTWS-ISFMETSAKTNHNVTELFQELLNM---EKTRTVSLQLDTKKQKKQ--------- 199
            ||...::.|. :.|.||||....||.|:|.:|:..   .:..:|::: |.:.|.:|         
Yeast   130 EGIEVSSKWGRVPFYETSALLRSNVDEVFVDLVRQIIRNEMESVAVK-DARNQSQQFSKIESPST 193

  Fly   200 ----KKEKKSKDTNGSIPENGDAGASASGGAKEK 229
                ..::.:|.:|......|....|:.|.||.|
Yeast   194 RLPSSAKQDTKQSNNKQSSKGLYNKSSQGQAKVK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 72/168 (43%)
RSR1NP_011668.3 RSR1 3..166 CDD:133377 72/165 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0395
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.