DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and RABA6a

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_177505.1 Gene:RABA6a / 843698 AraportID:AT1G73640 Length:233 Species:Arabidopsis thaliana


Alignment Length:220 Identity:69/220 - (31%)
Similarity:103/220 - (46%) Gaps:21/220 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 EQSNDY--RVVVFGAGGVGKSSLVLRFIKGTFRESYIPTI--EDTYRQVISCNKNICTLQITDTT 74
            |:..||  :.|:.|...||||:|:.||.|..||....|||  |..||.|...:| |...||.||.
plant     7 EEECDYLFKAVLIGDSAVGKSNLLSRFSKDEFRFDSKPTIGVEFAYRNVHVGDK-IIKAQIWDTA 70

  Fly    75 GSHQFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETA 139
            |..:|.|:...........:|:|.:..:.:.:.::. |  :.||:....|...|:|||||.| ..
plant    71 GQERFRAITSSYYRGALGALLIYDITRRTTFDNIKK-W--LFELRDFANPETVVVLVGNKSD-LR 131

  Fly   140 ELREVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKK 204
            :.|||.:.||:..|.:..:.|:||||..|.||.|.|  |:.:.:...|         ..|:...:
plant   132 QSREVEEDEGKTLAESEGLYFLETSALENVNVEEAF--LVMIGRIHEV---------VTQRIASE 185

  Fly   205 SKDTNGSIPE-NGDAGASASGGAKE 228
            :|....:.|. ||:...:.....||
plant   186 NKSNGAATPHINGNGNGTVLPVGKE 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 60/168 (36%)
RABA6aNP_177505.1 Rab11_like 11..175 CDD:206660 60/170 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.