DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and diras1

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001072780.1 Gene:diras1 / 780240 XenbaseID:XB-GENE-489505 Length:198 Species:Xenopus tropicalis


Alignment Length:194 Identity:144/194 - (74%)
Similarity:166/194 - (85%) Gaps:3/194 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||||||||||||||||||||||||||:|||||::|||||||||||||||:|::||||||||||||
 Frog     2 PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSH 66

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            |||||||||||||||||||:||.||||:|||:||:..|.::||: |.||||||||||||||.  |
 Frog    67 QFPAMQRLSISKGHAFILVFSVTSKQSIEELKPIYQQILQIKGS-IENIPVMLVGNKCDETQ--R 128

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSK 206
            ||...|.:|.|..|..:|||||||.|:||.||||||||:||.|.:||.:|.|:..|||:.:|.|
 Frog   129 EVDTKEVEALAKEWKCAFMETSAKMNYNVKELFQELLNLEKRRNMSLNIDGKRSSKQKRAEKIK 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 127/164 (77%)
diras1NP_001072780.1 P-loop_NTPase 7..169 CDD:422963 127/164 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 248 1.000 Domainoid score I2093
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 295 1.000 Inparanoid score I2688
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm49168
Panther 1 1.100 - - O PTHR24070
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.160

Return to query results.
Submit another query.