DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8500 and diras1b

DIOPT Version :9

Sequence 1:NP_001303452.1 Gene:CG8500 / 41203 FlyBaseID:FBgn0037754 Length:233 Species:Drosophila melanogaster
Sequence 2:NP_001119893.1 Gene:diras1b / 565395 ZFINID:ZDB-GENE-070912-620 Length:198 Species:Danio rerio


Alignment Length:221 Identity:148/221 - (66%)
Similarity:172/221 - (77%) Gaps:24/221 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PEQSNDYRVVVFGAGGVGKSSLVLRFIKGTFRESYIPTIEDTYRQVISCNKNICTLQITDTTGSH 77
            ||||||||||||||||||||||||||:|||||::||||:||||||||||:|::||||||||||||
Zfish     2 PEQSNDYRVVVFGAGGVGKSSLVLRFVKGTFRDTYIPTVEDTYRQVISCDKSVCTLQITDTTGSH 66

  Fly    78 QFPAMQRLSISKGHAFILVYSVCSKQSLEELRPIWALIKELKGADIPNIPVMLVGNKCDETAELR 142
            |||||||||||||||||||||:.||||||||:||:..|..:|| ::.|||:||||||.|||.  |
Zfish    67 QFPAMQRLSISKGHAFILVYSITSKQSLEELKPIYQQILAIKG-NVENIPIMLVGNKSDETQ--R 128

  Fly   143 EVSQAEGQAQATTWSISFMETSAKTNHNVTELFQELLNMEKTRTVSLQLDTKKQKKQKKEKKSKD 207
            ||...:|:||:.||..:|||||||||||||||||||||:||.|::||.:|.|:..||.:..|   
Zfish   129 EVKTEDGEAQSKTWKCAFMETSAKTNHNVTELFQELLNLEKKRSMSLNIDGKRSGKQSRADK--- 190

  Fly   208 TNGSIPENGDAGASASGGAKEKCRVM 233
                              .|.||.||
Zfish   191 ------------------LKGKCSVM 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8500NP_001303452.1 ARHI_like 18..183 CDD:206711 128/164 (78%)
diras1bNP_001119893.1 P-loop_NTPase 7..169 CDD:304359 128/164 (78%)
small_GTPase 17..171 CDD:197466 120/156 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 253 1.000 Domainoid score I2029
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 290 1.000 Inparanoid score I2785
OMA 1 1.010 - - QHG48239
OrthoDB 1 1.010 - - D1218505at2759
OrthoFinder 1 1.000 - - FOG0002912
OrthoInspector 1 1.000 - - otm25076
orthoMCL 1 0.900 - - OOG6_106316
Panther 1 1.100 - - LDO PTHR24070
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5443
SonicParanoid 1 1.000 - - X1920
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
1212.010

Return to query results.
Submit another query.